LL-37

$59.99 $39.99

LL-37 (Human Cathelicidin Antimicrobial Peptide) Product Information 🔬

This is a specialized research product of LL-37, the Human Cathelicidin Antimicrobial Peptide, strictly intended For In Vitro Research Use Only — Not for Human or Veterinary Use.

Description & Application

• Description: LL-37 is a cationic amphipathic peptide derived from the human cathelicidin antimicrobial protein hCAP-18.1 It is the only human cathelicidin identified to date.2

• Research Focus: LL-37 is of significant interest in laboratory models examining host defense peptides, bacterial resistance, and immunomodulation.3 It is widely studied in vitro for its role in:

  • Antimicrobial activity against bacteria, viruses, and fungi.4

  • Innate immune defense and host defense mechanisms.5

  • Wound healing and epithelial repair.6

  • Cell signaling and inflammatory pathway modulation.7

Specifications & Storage

• Unit Size: 5mg (lyophilized powder, single vial).

• Sequence: [LL-37, 37 aa]8

• Form: Crystalline lyophilized peptide.

• Molecular Formula: $\text{C}_{203}\text{H}_{318}\text{N}_{60}\text{O}_{49}$.

• Molecular Weight: $\sim 4493.3 \text{ Da}$.

• Solubility: Soluble in sterile water, $\text{PBS}$, or compatible buffers.

• Storage (Dry): Store dry at $2^{\circ}\text{C}–8^{\circ}\text{C}$.

⚠️ Legal & Intended Use

• Intended Use: This compound is intended strictly for in vitro laboratory research. It is not approved for human or animal use and must not be incorporated into food, drugs, cosmetics, or supplements.

• Legal Disclaimer: This product has not been evaluated by the U.S. Food and Drug Administration (FDA). No claims are made regarding diagnosis, treatment, cure, or prevention of disease. Research use is restricted to qualified professionals in certified laboratory environments.

• Terms of Sale: The buyer affirms they are a qualified researcher or institution, fully responsible for the lawful handling, storage, and research use of this material.9 All sales are final.